beta-Amyloid Peptide (1-42), Rat

REF : 171596-250UG
Marca : Sigma-Aldrich
Descrição :?-Amyloid Peptide (1-42), Rat Predominant peptide found in the brain of patients with Alzheimer's Disease and Down's Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.
Clique para mais informações
Categoria :
Descrição detalhada : Predominant peptide found in the brain of patients with Alzheimer's Disease and Down's Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons., beta-Amyloid Peptide (Abeta) is the main constituent in both senile plaques and diffuse deposits in Alzheimer's diseased brains. Under appropriate conditions, the soluble amyloid peptides aggregate into the fibrils associated with the disease state. It has proposed that Abeta peptide may increase the sensitivity of neurons to oxidative damage by downregulating expression of bcl-2, a key anti-apoptotic protein and upregulating of bax expression, a protein known to induce cell death.
Sinónimos : beta-Amyloid Peptide (1-42), Rat; DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Fórmula molecula r: C199H307N53O59S
Armazenamento : -20C
Embalagem : 1X250UG