PCSK9 Inhibitor, EGF-A – Calbiochem

REF : 5087610001
Marca : Sigma-Aldrich
Categoria :
Descrição detalhada : A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A. Binds to the proprotein convertase subtilisin/kexin type 9 (PCSK9) in a pH and calcium-dependent manner (Kd = 300 nM at pH 5.2 and 1.0 microM at pH7.4 and at 2 mM calcium) and blocks its interaction with LDL receptors (IC50 = 3.4 microM) and VLDL receptors (IC50 = 4.7 microM). Acts as a poor inhibitor of PCSK9 - Apo-ER2 interaction even at high concentrations (~200 microM). Blocks the degradation of mature LDL receptors in HepG2 cells in a dose-dependent manner (~1.5 to 15 microM)., A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A. Binds to the proprotein convertase subtilisin/kexin type 9 (PCSK9) in a pH and calcium-dependent manner (Kd = 300 nM at pH 5.2 and 1.0 microM at pH7.4 and at 2 mM calcium) and blocks its interaction with LDL receptors (IC50 = 3.4 microM) and VLDL receptors (IC50 = 4.7 microM). Acts as a poor inhibitor of PCSK9 - Apo-ER2 interaction even at high concentrations (~200 microM). Blocks the degradation of mature LDL receptors in HepG2 cells in a dose-dependent manner (~1.5 to 15 microM).Please note that the molecular weight for this compound is batch-specific due to variable water content.
Sinónimos : PCSK9 Inhibitor, EGF-A - Calbiochem
Fórmula molecula r: C188H292N58O65S6
Armazenamento : -20C
Embalagem : 1X1EA